CDS

Accession Number TCMCG033C19964
gbkey CDS
Protein Id TQD94452.1
Location complement(join(377635..377752,377838..378001))
Organism Malus baccata
locus_tag C1H46_019942

Protein

Length 93aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA428857, BioSample:SAMN08323692
db_source VIEB01000342.1
Definition hypothetical protein C1H46_019942 [Malus baccata]
Locus_tag C1H46_019942

EGGNOG-MAPPER Annotation

COG_category F
Description Pyrophosphatase that hydrolyzes non-canonical purine nucleotides such as inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) or xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions
KEGG_TC -
KEGG_Module -
KEGG_Reaction R00426        [VIEW IN KEGG]
R00720        [VIEW IN KEGG]
R01855        [VIEW IN KEGG]
R02100        [VIEW IN KEGG]
R02720        [VIEW IN KEGG]
R03531        [VIEW IN KEGG]
R08243        [VIEW IN KEGG]
KEGG_rclass RC00002        [VIEW IN KEGG]
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
KEGG_ko ko:K01519        [VIEW IN KEGG]
EC -
KEGG_Pathway ko00230        [VIEW IN KEGG]
ko00983        [VIEW IN KEGG]
ko01100        [VIEW IN KEGG]
map00230        [VIEW IN KEGG]
map00983        [VIEW IN KEGG]
map01100        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0006139        [VIEW IN EMBL-EBI]
GO:0006725        [VIEW IN EMBL-EBI]
GO:0006753        [VIEW IN EMBL-EBI]
GO:0006793        [VIEW IN EMBL-EBI]
GO:0006796        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009056        [VIEW IN EMBL-EBI]
GO:0009058        [VIEW IN EMBL-EBI]
GO:0009141        [VIEW IN EMBL-EBI]
GO:0009143        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0016462        [VIEW IN EMBL-EBI]
GO:0016787        [VIEW IN EMBL-EBI]
GO:0016817        [VIEW IN EMBL-EBI]
GO:0016818        [VIEW IN EMBL-EBI]
GO:0018130        [VIEW IN EMBL-EBI]
GO:0019438        [VIEW IN EMBL-EBI]
GO:0019439        [VIEW IN EMBL-EBI]
GO:0019637        [VIEW IN EMBL-EBI]
GO:0034404        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0034654        [VIEW IN EMBL-EBI]
GO:0034655        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044248        [VIEW IN EMBL-EBI]
GO:0044249        [VIEW IN EMBL-EBI]
GO:0044270        [VIEW IN EMBL-EBI]
GO:0044271        [VIEW IN EMBL-EBI]
GO:0044281        [VIEW IN EMBL-EBI]
GO:0044283        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046434        [VIEW IN EMBL-EBI]
GO:0046483        [VIEW IN EMBL-EBI]
GO:0046700        [VIEW IN EMBL-EBI]
GO:0047429        [VIEW IN EMBL-EBI]
GO:0055086        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:1901292        [VIEW IN EMBL-EBI]
GO:1901360        [VIEW IN EMBL-EBI]
GO:1901361        [VIEW IN EMBL-EBI]
GO:1901362        [VIEW IN EMBL-EBI]
GO:1901575        [VIEW IN EMBL-EBI]
GO:1901576        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGTTTAGATTGTGGAAATGGTTATACAATCACGGGATGGTTAACAGAGAATGTGGCACTAACATGCAATTTGTGGATGAATTCCAGGGGAGAATAGTTCCGGCAAGGGGACCAACTGATTTTGGATGGGATCCAGTCTTCCAACCTGATGGTTACGAGCAGACTTATGCCGAGATGCCGAAGGAAGAAAAGAACAAGATTTCTCATCGCTTTAGAGCTCTTGCACTGGTGAAGTCTCACTTTGCTGAAGCTGGGTACACCTTTGAGACAAACTGTGTGTAA
Protein:  
MFRLWKWLYNHGMVNRECGTNMQFVDEFQGRIVPARGPTDFGWDPVFQPDGYEQTYAEMPKEEKNKISHRFRALALVKSHFAEAGYTFETNCV